Recombinant Human SH3RF2 protein, His-tagged
Cat.No. : | SH3RF2-3968H |
Product Overview : | Recombinant Human SH3RF2 protein(75-295 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 75-295 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MRKSKWWQRDGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSEARIHSAASSLIMEDKEIPIKSEPLPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SH3RF2 SH3 domain containing ring finger 2 [ Homo sapiens ] |
Official Symbol | SH3RF2 |
Synonyms | SH3RF2; SH3 domain containing ring finger 2; PPP1R39, protein phosphatase 1, regulatory subunit 39; putative E3 ubiquitin-protein ligase SH3RF2; FLJ23654; heart protein phosphatase 1 binding protein; Hepp1; POSH eliminating RING protein; POSHER; RNF158; RING finger protein 158; POSH-eliminating RING protein; SH3 domain-containing RING finger protein 2; heart protein phosphatase 1-binding protein; protein phosphatase 1 regulatory subunit 39; protein phosphatase 1, regulatory subunit 39; HEPP1; PPP1R39; MGC90410; MGC149788; MGC149789; |
Gene ID | 153769 |
mRNA Refseq | NM_152550 |
Protein Refseq | NP_689763 |
MIM | 613377 |
UniProt ID | Q8TEC5 |
◆ Recombinant Proteins | ||
SH3RF2-15079M | Recombinant Mouse SH3RF2 Protein | +Inquiry |
SH3RF2-5383R | Recombinant Rat SH3RF2 Protein | +Inquiry |
SH3RF2-8132M | Recombinant Mouse SH3RF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH3RF2-5042R | Recombinant Rat SH3RF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH3RF2-3968H | Recombinant Human SH3RF2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3RF2-1863HCL | Recombinant Human SH3RF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH3RF2 Products
Required fields are marked with *
My Review for All SH3RF2 Products
Required fields are marked with *
0
Inquiry Basket