Recombinant Human SH3RF2 protein, His-tagged

Cat.No. : SH3RF2-3968H
Product Overview : Recombinant Human SH3RF2 protein(75-295 aa), fused to His tag, was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 75-295 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MRKSKWWQRDGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSEARIHSAASSLIMEDKEIPIKSEPLPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SH3RF2 SH3 domain containing ring finger 2 [ Homo sapiens ]
Official Symbol SH3RF2
Synonyms SH3RF2; SH3 domain containing ring finger 2; PPP1R39, protein phosphatase 1, regulatory subunit 39; putative E3 ubiquitin-protein ligase SH3RF2; FLJ23654; heart protein phosphatase 1 binding protein; Hepp1; POSH eliminating RING protein; POSHER; RNF158; RING finger protein 158; POSH-eliminating RING protein; SH3 domain-containing RING finger protein 2; heart protein phosphatase 1-binding protein; protein phosphatase 1 regulatory subunit 39; protein phosphatase 1, regulatory subunit 39; HEPP1; PPP1R39; MGC90410; MGC149788; MGC149789;
Gene ID 153769
mRNA Refseq NM_152550
Protein Refseq NP_689763
MIM 613377
UniProt ID Q8TEC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH3RF2 Products

Required fields are marked with *

My Review for All SH3RF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon