Recombinant Human SH3TC2 protein, GST-tagged
Cat.No. : | SH3TC2-8544H |
Product Overview : | Recombinant Human SH3TC2 protein(254-467 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 254-467 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | CGLSRKRDWTGSYQIGRGRCKALTGYEPGEKDELNFYQGESIEIIGFVIPGLQWFIGKSTSSGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQPEGFKEVRPGRAWEEHQAVGSRQSSSSEDSSLEEELLSATSDSYRLPEPDDLDDPELLMDLSTGQEEEAENF |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SH3TC2 SH3 domain and tetratricopeptide repeats 2 [ Homo sapiens ] |
Official Symbol | SH3TC2 |
Synonyms | SH3TC2; SH3 domain and tetratricopeptide repeats 2; SH3 domain and tetratricopeptide repeat-containing protein 2; CMT4C; KIAA1985; SH3 domain and tetratricopeptide repeats-containing protein 2; MNMN; FLJ13605; |
mRNA Refseq | NM_024577 |
Protein Refseq | NP_078853 |
MIM | 608206 |
UniProt ID | Q8TF17 |
Gene ID | 79628 |
◆ Recombinant Proteins | ||
SH3TC2-8544H | Recombinant Human SH3TC2 protein, GST-tagged | +Inquiry |
SH3TC2-3273H | Recombinant Human SH3TC2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH3TC2 Products
Required fields are marked with *
My Review for All SH3TC2 Products
Required fields are marked with *
0
Inquiry Basket