Recombinant Human SHC1 protein, MBP&His-Avi-tagged, Biotinylated
| Cat.No. : | SHC1-9383H |
| Product Overview : | Biotinylated Recombinant Human SHC1 protein(P29353)(150-320aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His&MBP |
| Protein Length : | 150-320aa |
| Conjugation/Label : | Biotin |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 66.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP |
| Conjugation : | Biotin |
| Gene Name | SHC1 SHC (Src homology 2 domain containing) transforming protein 1 [ Homo sapiens ] |
| Official Symbol | SHC1 |
| Synonyms | SHC1; SHC (Src homology 2 domain containing) transforming protein 1; SHC, SHC (Src homology 2 domain containing) transforming protein 1; SHC-transforming protein 1; p66; SH2 domain protein C1; SHC-transforming protein 3; SHC-transforming protein A; SHC (Src homology 2 domain-containing) transforming protein 1; SHC; SHCA; FLJ26504; |
| Gene ID | 6464 |
| mRNA Refseq | NM_001130040 |
| Protein Refseq | NP_001123512 |
| MIM | 600560 |
| UniProt ID | P29353 |
| ◆ Recombinant Proteins | ||
| SHC1-9383H | Recombinant Human SHC1 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
| SHC1-4008R | Recombinant Rhesus Macaque SHC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SHC1-2444H | Recombinant Human SHC1 protein, His-tagged | +Inquiry |
| SHC1-6283H | Recombinant Human SHC1 Protein (Glu272-His559), N-His tagged | +Inquiry |
| SHC1-15090M | Recombinant Mouse SHC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SHC1-1862HCL | Recombinant Human SHC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHC1 Products
Required fields are marked with *
My Review for All SHC1 Products
Required fields are marked with *
