Recombinant Human SHC1 protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | SHC1-9383H |
Product Overview : | Biotinylated Recombinant Human SHC1 protein(P29353)(150-320aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 150-320aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP |
Gene Name | SHC1 SHC (Src homology 2 domain containing) transforming protein 1 [ Homo sapiens ] |
Official Symbol | SHC1 |
Synonyms | SHC1; SHC (Src homology 2 domain containing) transforming protein 1; SHC, SHC (Src homology 2 domain containing) transforming protein 1; SHC-transforming protein 1; p66; SH2 domain protein C1; SHC-transforming protein 3; SHC-transforming protein A; SHC (Src homology 2 domain-containing) transforming protein 1; SHC; SHCA; FLJ26504; |
Gene ID | 6464 |
mRNA Refseq | NM_001130040 |
Protein Refseq | NP_001123512 |
MIM | 600560 |
UniProt ID | P29353 |
◆ Recombinant Proteins | ||
SHC1-3579H | Recombinant Human SHC1, His-tagged | +Inquiry |
SHC1-2654H | Recombinant Human SHC1, GST-tagged | +Inquiry |
Shc1-5854M | Recombinant Mouse Shc1 Protein, Myc/DDK-tagged | +Inquiry |
SHC1-30065TH | Recombinant Human SHC1, His-tagged | +Inquiry |
SHC1-4008R | Recombinant Rhesus Macaque SHC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHC1-1862HCL | Recombinant Human SHC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHC1 Products
Required fields are marked with *
My Review for All SHC1 Products
Required fields are marked with *
0
Inquiry Basket