Recombinant Human SHISAL2A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SHISAL2A-6274H
• Product Overview: FAM159A MS Standard C13 and N15-labeled recombinant protein (NP_001036158) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SHISAL2A (Shisa Like 2A) is a Protein Coding gene. An important paralog of this gene is SHISAL2B.
• Molecular Mass: 20.1 kDa
• AA Sequence: MSGACTSYVSAEQEVVRGFSCPRPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHSYMWWLSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSDIPGSPEEASVPNPDLCGPVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SHISAL2A shisa like 2A [ Homo sapiens (human) ]
• Official Symbol: SHISAL2A
• Synonyms: SHISAL2A; shisa like 2A; FAM159A; PRO7171; WWLS2783; protein shisa-like-2A; family with sequence similarity 159 member A; membrane protein FAM159A
• Gene ID: 348378
• mRNA Refseq: NM_001042693
• Protein Refseq: NP_001036158
• UniProt ID: Q6UWV7