Recombinant Human SHISAL2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SHISAL2A-6274H
Product Overview : FAM159A MS Standard C13 and N15-labeled recombinant protein (NP_001036158) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SHISAL2A (Shisa Like 2A) is a Protein Coding gene. An important paralog of this gene is SHISAL2B.
Molecular Mass : 20.1 kDa
AA Sequence : MSGACTSYVSAEQEVVRGFSCPRPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHSYMWWLSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSDIPGSPEEASVPNPDLCGPVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SHISAL2A shisa like 2A [ Homo sapiens (human) ]
Official Symbol SHISAL2A
Synonyms SHISAL2A; shisa like 2A; FAM159A; PRO7171; WWLS2783; protein shisa-like-2A; family with sequence similarity 159 member A; membrane protein FAM159A
Gene ID 348378
mRNA Refseq NM_001042693
Protein Refseq NP_001036158
UniProt ID Q6UWV7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SHISAL2A Products

Required fields are marked with *

My Review for All SHISAL2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon