Recombinant Human SIAH1 Protein, His-tagged
| Cat.No. : | SIAH1-4354H |
| Product Overview : | Recombinant Human SIAH1 Protein(1-50 aa), fused with N-terminal His Tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-50 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | SIAH1 siah E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
| Official Symbol | SIAH1 |
| Synonyms | SIAH1; siah E3 ubiquitin protein ligase 1; seven in absentia homolog 1 (Drosophila); E3 ubiquitin-protein ligase SIAH1; hSIAH1; siah-1a; seven in absentia homolog 1; SIAH1A; FLJ08065; |
| Gene ID | 6477 |
| mRNA Refseq | NM_001006610 |
| Protein Refseq | NP_001006611 |
| MIM | 602212 |
| UniProt ID | Q8IUQ4 |
| ◆ Recombinant Proteins | ||
| SIAH1-4016R | Recombinant Rhesus Macaque SIAH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIAH1-4353H | Recombinant Human SIAH1 protein, GST-tagged | +Inquiry |
| SIAH1-4629H | Recombinant Human SIAH1 protein, GST-tagged | +Inquiry |
| SIAH1-2668H | Recombinant Human SIAH1 protein, GST-tagged | +Inquiry |
| SIAH1-4200R | Recombinant Rhesus monkey SIAH1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIAH1-1851HCL | Recombinant Human SIAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIAH1 Products
Required fields are marked with *
My Review for All SIAH1 Products
Required fields are marked with *
