Recombinant Human SIAH1 protein, GST-tagged
Cat.No. : | SIAH1-2668H |
Product Overview : | Recombinant Human SIAH1 protein(1-282 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-282 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SIAH1 siah E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
Official Symbol | SIAH1 |
Synonyms | SIAH1; siah E3 ubiquitin protein ligase 1; seven in absentia homolog 1 (Drosophila); E3 ubiquitin-protein ligase SIAH1; hSIAH1; siah-1a; seven in absentia homolog 1; SIAH1A; FLJ08065; |
Gene ID | 6477 |
mRNA Refseq | NM_001006610 |
Protein Refseq | NP_001006611 |
MIM | 602212 |
UniProt ID | Q8IUQ4 |
◆ Recombinant Proteins | ||
SIAH1-4200R | Recombinant Rhesus monkey SIAH1 Protein, His-tagged | +Inquiry |
SIAH1-4353H | Recombinant Human SIAH1 protein, GST-tagged | +Inquiry |
SIAH1-4016R | Recombinant Rhesus Macaque SIAH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIAH1-9929Z | Recombinant Zebrafish SIAH1 | +Inquiry |
SIAH1-2668H | Recombinant Human SIAH1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIAH1-1851HCL | Recombinant Human SIAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIAH1 Products
Required fields are marked with *
My Review for All SIAH1 Products
Required fields are marked with *