Recombinant Human SIGLEC5 protein, His-tagged

Cat.No. : SIGLEC5-514H
Product Overview : Recombinant Human SIGLEC5 protein(NP_003821)(241-442 aa), fused to His tag, was expressed in E. coli.
Availability December 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 241-442 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQSGSVLLLQGRSNLGTGVVPAALG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name SIGLEC5 sialic acid binding Ig-like lectin 5 [ Homo sapiens ]
Official Symbol SIGLEC5
Synonyms SIGLEC5; sialic acid binding Ig-like lectin 5; CD33L2; sialic acid-binding Ig-like lectin 5; CD170; OB BP2; SIGLEC 5; CD33 antigen-like 2; OB-binding protein 2; obesity-binding protein 2; sialic acid-binding immunoglobulin-like lectin 5; OBBP2; OB-BP2; SIGLEC-5;
Gene ID 8778
mRNA Refseq NM_003830
Protein Refseq NP_003821
MIM 604200
UniProt ID O15389

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGLEC5 Products

Required fields are marked with *

My Review for All SIGLEC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon