Recombinant Human SIGLEC5 protein, His-tagged
| Cat.No. : | SIGLEC5-514H |
| Product Overview : | Recombinant Human SIGLEC5 protein(NP_003821)(241-442 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 241-442 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQSGSVLLLQGRSNLGTGVVPAALG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | SIGLEC5 sialic acid binding Ig-like lectin 5 [ Homo sapiens ] |
| Official Symbol | SIGLEC5 |
| Synonyms | SIGLEC5; sialic acid binding Ig-like lectin 5; CD33L2; sialic acid-binding Ig-like lectin 5; CD170; OB BP2; SIGLEC 5; CD33 antigen-like 2; OB-binding protein 2; obesity-binding protein 2; sialic acid-binding immunoglobulin-like lectin 5; OBBP2; OB-BP2; SIGLEC-5; |
| Gene ID | 8778 |
| mRNA Refseq | NM_003830 |
| Protein Refseq | NP_003821 |
| MIM | 604200 |
| UniProt ID | O15389 |
| ◆ Recombinant Proteins | ||
| SIGLEC5-8554H | Recombinant Human SIGLEC5 protein, hFc-tagged, Biotinylated | +Inquiry |
| SIGLEC5-0941H | Recombinant Human SIGLEC5 Protein (Phe458-Lys551), N-His tagged | +Inquiry |
| SIGLEC5-5674H | Recombinant Human SIGLEC5 protein, His & S-tagged | +Inquiry |
| SIGLEC5-941H | Active Recombinant Human SIGLEC5 Protein, Fc Chimera | +Inquiry |
| SIGLEC5-428H | Recombinant Human SIGLEC5 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIGLEC5-1075HCL | Recombinant Human SIGLEC5 cell lysate | +Inquiry |
| SIGLEC5-1505HCL | Recombinant Human SIGLEC5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGLEC5 Products
Required fields are marked with *
My Review for All SIGLEC5 Products
Required fields are marked with *
