Recombinant Human SIPA1 protein, His-tagged
Cat.No. : | SIPA1-3090H |
Product Overview : | Recombinant Human SIPA1 protein(950-1042 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 950-1042 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SIPA1 signal-induced proliferation-associated 1 [ Homo sapiens ] |
Official Symbol | SIPA1 |
Synonyms | SIPA1; signal-induced proliferation-associated 1; signal-induced proliferation-associated protein 1; SPA1; sipa-1; p130 SPA-1; GTPase-activating protein Spa-1; signal-induced proliferation-associated gene 1; MGC17037; MGC102688; |
mRNA Refseq | NM_006747 |
Protein Refseq | NP_006738 |
MIM | 602180 |
UniProt ID | Q96FS4 |
Gene ID | 6494 |
◆ Recombinant Proteins | ||
SIPA1-3090H | Recombinant Human SIPA1 protein, His-tagged | +Inquiry |
SIPA1-301389H | Recombinant Human SIPA1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIPA1 Products
Required fields are marked with *
My Review for All SIPA1 Products
Required fields are marked with *