Recombinant Human SIPA1 protein, His-tagged

Cat.No. : SIPA1-3090H
Product Overview : Recombinant Human SIPA1 protein(950-1042 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 950-1042 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : GQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name SIPA1 signal-induced proliferation-associated 1 [ Homo sapiens ]
Official Symbol SIPA1
Synonyms SIPA1; signal-induced proliferation-associated 1; signal-induced proliferation-associated protein 1; SPA1; sipa-1; p130 SPA-1; GTPase-activating protein Spa-1; signal-induced proliferation-associated gene 1; MGC17037; MGC102688;
mRNA Refseq NM_006747
Protein Refseq NP_006738
MIM 602180
UniProt ID Q96FS4
Gene ID 6494

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIPA1 Products

Required fields are marked with *

My Review for All SIPA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon