Recombinant Human SIRPA protein, His&Myc-tagged

Cat.No. : SIRPA-4554H
Product Overview : Recombinant Human SIRPA protein(P78324)(1-131aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-131aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 21.5 kDa
AA Sequence : MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SIRPA signal-regulatory protein alpha [ Homo sapiens ]
Official Symbol SIRPA
Synonyms SIRPA; signal-regulatory protein alpha; protein tyrosine phosphatase, non receptor type substrate 1 , PTPNS1; tyrosine-protein phosphatase non-receptor type substrate 1; BIT; CD172a; MFR; MYD 1; P84; SHPS 1; SHPS1; SIRP; SIRP ALPHA 1; SIRPalpha; SIRPalpha2; myd-1 antigen; inhibitory receptor SHPS-1; macrophage fusion receptor; CD172 antigen-like family member A; tyrosine phosphatase SHP substrate 1; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; MYD-1; CD172A; PTPNS1;
Gene ID 140885
mRNA Refseq NM_001040022
Protein Refseq NP_001035111
MIM 602461
UniProt ID P78324

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIRPA Products

Required fields are marked with *

My Review for All SIRPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon