Recombinant Human SIRPA protein, His&Myc-tagged
Cat.No. : | SIRPA-4554H |
Product Overview : | Recombinant Human SIRPA protein(P78324)(1-131aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-131aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SIRPA signal-regulatory protein alpha [ Homo sapiens ] |
Official Symbol | SIRPA |
Synonyms | SIRPA; signal-regulatory protein alpha; protein tyrosine phosphatase, non receptor type substrate 1 , PTPNS1; tyrosine-protein phosphatase non-receptor type substrate 1; BIT; CD172a; MFR; MYD 1; P84; SHPS 1; SHPS1; SIRP; SIRP ALPHA 1; SIRPalpha; SIRPalpha2; myd-1 antigen; inhibitory receptor SHPS-1; macrophage fusion receptor; CD172 antigen-like family member A; tyrosine phosphatase SHP substrate 1; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; MYD-1; CD172A; PTPNS1; |
Gene ID | 140885 |
mRNA Refseq | NM_001040022 |
Protein Refseq | NP_001035111 |
MIM | 602461 |
UniProt ID | P78324 |
◆ Recombinant Proteins | ||
SIRPA-724H | Recombinant Human SIRPA Protein, IgG1 Fc-tagged | +Inquiry |
Sirpa-23RAF555 | Recombinant Rat Sirpa Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
SIRPA-3493H | Recombinant Human SIRPA protein, His-SUMO-tagged | +Inquiry |
SIRPA-051H | Active Recombinant Human SIRPA protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
SIRPA-1389H | Acitve Recombinant Human SIRPA protein(Met1-Arg369(S44L, S50T, I52T, H54R, V57A)), mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRPA-2298HCL | Recombinant Human SIRPA cell lysate | +Inquiry |
SIRPA-1005RCL | Recombinant Rat SIRPA cell lysate | +Inquiry |
SIRPA-1650MCL | Recombinant Mouse SIRPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIRPA Products
Required fields are marked with *
My Review for All SIRPA Products
Required fields are marked with *
0
Inquiry Basket