Recombinant Human SIRPD Protein (30-197 aa), His-SUMO-tagged

Cat.No. : SIRPD-811H
Product Overview : Recombinant Human SIRPD Protein (30-197 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 30-197 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 34.6 kDa
AA Sequence : FHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name SIRPD signal regulatory protein delta [ Homo sapiens (human) ]
Official Symbol SIRPD
Synonyms PTPNS1L2; dJ576H24.4;
Gene ID 128646
mRNA Refseq NM_178460
Protein Refseq NP_848555
UniProt ID Q9H106

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIRPD Products

Required fields are marked with *

My Review for All SIRPD Products

Required fields are marked with *

0
cart-icon