Recombinant Human SIRT3 protein, GST-tagged

• Cat.No.: SIRT3-7844H
• Product Overview: Recombinant Human SIRT3 protein(300-399 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 300-399 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SIRT3
• Synonyms: SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3; sir2-like 3; sirtuin type 3; SIR2-like protein 3; silent mating type information regulation 2, S.cerevisiae, homolog 3; mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase
• Gene ID: 23410
• mRNA Refseq: NM_001017524
• Protein Refseq: NP_001017524
• MIM: 604481
• UniProt ID: Q9NTG7