Recombinant Human SIRT5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SIRT5-2646H |
Product Overview : | SIRT5 MS Standard C13 and N15-labeled recombinant protein (NP_036373) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Mass : | 33.9 kDa |
AA Sequence : | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SIRT5 sirtuin 5 [ Homo sapiens (human) ] |
Official Symbol | SIRT5 |
Synonyms | SIRT5; sirtuin 5; sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; sir2-like 5; sirtuin type 5; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; silent mating type information regulation 2, S.cerevisiae, homolog 5; SIR2L5; FLJ36950; |
Gene ID | 23408 |
mRNA Refseq | NM_012241 |
Protein Refseq | NP_036373 |
MIM | 604483 |
UniProt ID | Q9NXA8 |
◆ Recombinant Proteins | ||
SIRT5-2434H | Recombinant human SIRT5, His-tagged | +Inquiry |
SIRT5-31167TH | Recombinant Human SIRT5 | +Inquiry |
SIRT5-15155M | Recombinant Mouse SIRT5 Protein | +Inquiry |
SIRT5-110H | Recombinant Human SIRT5 Protein, GST-tagged | +Inquiry |
Sirt5-4556M | Recombinant Mouse Sirt5 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT5 Products
Required fields are marked with *
My Review for All SIRT5 Products
Required fields are marked with *