Recombinant Human SIRT5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SIRT5-2646H
Product Overview : SIRT5 MS Standard C13 and N15-labeled recombinant protein (NP_036373) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants.
Molecular Mass : 33.9 kDa
AA Sequence : MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SIRT5 sirtuin 5 [ Homo sapiens (human) ]
Official Symbol SIRT5
Synonyms SIRT5; sirtuin 5; sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; sir2-like 5; sirtuin type 5; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; silent mating type information regulation 2, S.cerevisiae, homolog 5; SIR2L5; FLJ36950;
Gene ID 23408
mRNA Refseq NM_012241
Protein Refseq NP_036373
MIM 604483
UniProt ID Q9NXA8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIRT5 Products

Required fields are marked with *

My Review for All SIRT5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon