Recombinant Mouse Sirt5 protein, His&Myc-tagged

Cat.No. : Sirt5-4555M
Product Overview : Recombinant Mouse Sirt5 protein(Q8K2C6)(37–310aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 37–310aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.6 kDa
AA Sequence : SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Sirt5 sirtuin 5 (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) [ Mus musculus ]
Official Symbol Sirt5
Synonyms SIRT5; sirtuin 5 (silent mating type information regulation 2 homolog) 5 (S. cerevisiae); NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; SIR2-like protein 5; NAD-dependent deacetylase sirtuin-5; AV001953; 0610012J09Rik; 1500032M05Rik;
Gene ID 68346
mRNA Refseq NM_178848
Protein Refseq NP_849179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sirt5 Products

Required fields are marked with *

My Review for All Sirt5 Products

Required fields are marked with *

0
cart-icon