Recombinant Human SIVA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SIVA1-4967H |
Product Overview : | SIVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFETTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SIVA1 SIVA1 apoptosis inducing factor [ Homo sapiens (human) ] |
Official Symbol | SIVA1 |
Synonyms | SIVA1; SIVA1, apoptosis-inducing factor; apoptosis regulatory protein Siva; CD27BP; SIVA; Siva 1; Siva 2; CD27-binding (Siva) protein; Siva-1; Siva-2; |
Gene ID | 10572 |
mRNA Refseq | NM_006427 |
Protein Refseq | NP_006418 |
MIM | 605567 |
UniProt ID | O15304 |
◆ Recombinant Proteins | ||
SIVA1-812H | Recombinant Human SIVA1 Protein (1-110 aa), His-SUMO-tagged | +Inquiry |
SIVA1-4209R | Recombinant Rhesus monkey SIVA1 Protein, His-tagged | +Inquiry |
SIVA1-3615H | Recombinant Human SIVA1 protein, GST-tagged | +Inquiry |
Siva1-3583M | Recombinant Mouse Siva1, His-tagged | +Inquiry |
SIVA1-6743H | Recombinant Human SIVA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIVA1-1826HCL | Recombinant Human SIVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIVA1 Products
Required fields are marked with *
My Review for All SIVA1 Products
Required fields are marked with *
0
Inquiry Basket