Recombinant Human SIVA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SIVA1-4967H |
| Product Overview : | SIVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. |
| Molecular Mass : | 18.5 kDa |
| AA Sequence : | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFETTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SIVA1 SIVA1 apoptosis inducing factor [ Homo sapiens (human) ] |
| Official Symbol | SIVA1 |
| Synonyms | SIVA1; SIVA1, apoptosis-inducing factor; apoptosis regulatory protein Siva; CD27BP; SIVA; Siva 1; Siva 2; CD27-binding (Siva) protein; Siva-1; Siva-2; |
| Gene ID | 10572 |
| mRNA Refseq | NM_006427 |
| Protein Refseq | NP_006418 |
| MIM | 605567 |
| UniProt ID | O15304 |
| ◆ Recombinant Proteins | ||
| SIVA1-3584H | Recombinant Human SIVA1, His-tagged | +Inquiry |
| SIVA1-8185M | Recombinant Mouse SIVA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIVA1-277H | Recombinant Human SIVA1, apoptosis-inducing factor, His-tagged | +Inquiry |
| SIVA1-4923C | Recombinant Chicken SIVA1 | +Inquiry |
| SIVA1-6743H | Recombinant Human SIVA1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIVA1-1826HCL | Recombinant Human SIVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIVA1 Products
Required fields are marked with *
My Review for All SIVA1 Products
Required fields are marked with *



