Recombinant Human SKA2 protein, T7/His-tagged

Cat.No. : SKA2-195H
Product Overview : Recombinant human SKA2 cDNA (121aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT .
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLL KELSVIKSRYQTLYARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human SKA2 mediated neuronal response with stress hormones regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name SKA2 spindle and kinetochore associated complex subunit 2 [ Homo sapiens ]
Official Symbol SKA2
Synonyms SKA2; spindle and kinetochore associated complex subunit 2; FAM33A, family with sequence similarity 33, member A; spindle and kinetochore-associated protein 2; FLJ12758; spindle and KT (kinetochore) associated 2; family with sequence similarity 33, member A; FAM33A; MGC110975;
Gene ID 348235
mRNA Refseq NM_001100595
Protein Refseq NP_001094065
MIM
UniProt ID Q8WVK7
Chromosome Location 17q23.2
Pathway Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem;
Function microtubule binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SKA2 Products

Required fields are marked with *

My Review for All SKA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon