Recombinant Human SLAMF6 protein, hFc-Flag-tagged

Cat.No. : SLAMF6-7354H
Product Overview : Recombinant Human SLAMF6 protein(Q96DU3)(22-226aa), fused with C-terminal hFc and Flag tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&Flag
Protein Length : 22-226aa
Tag : C-hFc-Flag
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM
Gene Name SLAMF6 SLAM family member 6 [ Homo sapiens ]
Official Symbol SLAMF6
Synonyms SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953;
Gene ID 114836
mRNA Refseq NM_001184714
Protein Refseq NP_001171643
MIM 606446
UniProt ID Q96DU3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLAMF6 Products

Required fields are marked with *

My Review for All SLAMF6 Products

Required fields are marked with *

0
cart-icon