Recombinant Human SLAMF6 protein, hFc-Flag-tagged
| Cat.No. : | SLAMF6-7354H |
| Product Overview : | Recombinant Human SLAMF6 protein(Q96DU3)(22-226aa), fused with C-terminal hFc and Flag tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&Flag |
| Protein Length : | 22-226aa |
| Tag : | C-hFc-Flag |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM |
| Gene Name | SLAMF6 SLAM family member 6 [ Homo sapiens ] |
| Official Symbol | SLAMF6 |
| Synonyms | SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953; |
| Gene ID | 114836 |
| mRNA Refseq | NM_001184714 |
| Protein Refseq | NP_001171643 |
| MIM | 606446 |
| UniProt ID | Q96DU3 |
| ◆ Recombinant Proteins | ||
| SLAMF6-1774R | Recombinant Rhesus Monkey SLAMF6 Protein, hIgG1-tagged | +Inquiry |
| SLAMF6-3945H | Recombinant Human SLAMF6, His tagged | +Inquiry |
| SLAMF6-1953H | Recombinant Human SLAMF6 protein, hFc-tagged | +Inquiry |
| SLAMF6-1178H | Recombinant Human SLAMF6 protein(Met1-Met226) | +Inquiry |
| SLAMF6-687H | Active Recombinant Human SLAMF6, Fc-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLAMF6-2108MCL | Recombinant Mouse SLAMF6 cell lysate | +Inquiry |
| SLAMF6-913HCL | Recombinant Human SLAMF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF6 Products
Required fields are marked with *
My Review for All SLAMF6 Products
Required fields are marked with *



