Recombinant Human SLAMF6 protein, His&Myc-tagged
Cat.No. : | SLAMF6-4558H |
Product Overview : | Recombinant Human SLAMF6 protein(Q96DU3)(22-226aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 22-226aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SLAMF6 SLAM family member 6 [ Homo sapiens ] |
Official Symbol | SLAMF6 |
Synonyms | SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953; |
Gene ID | 114836 |
mRNA Refseq | NM_001184714 |
Protein Refseq | NP_001171643 |
MIM | 606446 |
UniProt ID | Q96DU3 |
◆ Recombinant Proteins | ||
SLAMF6-242H | Active Recombinant Human SLAMF6 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
SLAMF6-1953H | Recombinant Human SLAMF6 protein, hFc-tagged | +Inquiry |
Slamf6-144M | Recombinant Mouse Slamf6 Protein, His-tagged | +Inquiry |
SLAMF6-5600H | Recombinant Human SLAMF6 Protein (Leu28-Lys225), C-His tagged | +Inquiry |
SLAMF6-5643H | Recombinant Human SLAMF6 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF6-913HCL | Recombinant Human SLAMF6 cell lysate | +Inquiry |
SLAMF6-2108MCL | Recombinant Mouse SLAMF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLAMF6 Products
Required fields are marked with *
My Review for All SLAMF6 Products
Required fields are marked with *
0
Inquiry Basket