Recombinant Human SLAMF7 protein, GST-tagged

Cat.No. : SLAMF7-19H
Product Overview : Recombinant Human SLAMF7(1 a.a. - 296 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 296 a.a.
Description : SLAMF7 played an impotant role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 58.3 kDa
AA Sequence : MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLAMF7 SLAM family member 7 [ Homo sapiens ]
Official Symbol SLAMF7
Synonyms SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein;
Gene ID 57823
mRNA Refseq NM_021181
Protein Refseq NP_067004
MIM 606625
UniProt ID Q9NQ25
Chromosome Location 1q23.1-q24.1
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLAMF7 Products

Required fields are marked with *

My Review for All SLAMF7 Products

Required fields are marked with *

0
cart-icon