Recombinant Human SLAMF7 protein, GST-tagged
Cat.No. : | SLAMF7-19H |
Product Overview : | Recombinant Human SLAMF7(1 a.a. - 296 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 296 a.a. |
Description : | SLAMF7 played an impotant role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 58.3 kDa |
AA Sequence : | MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens ] |
Official Symbol | SLAMF7 |
Synonyms | SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; |
Gene ID | 57823 |
mRNA Refseq | NM_021181 |
Protein Refseq | NP_067004 |
MIM | 606625 |
UniProt ID | Q9NQ25 |
Chromosome Location | 1q23.1-q24.1 |
Function | receptor activity; |
◆ Recombinant Proteins | ||
SLAMF7-2688H | Active Recombinant Human SLAMF7 protein, hFc&His-tagged | +Inquiry |
SLAMF7-1424H | Recombinant Human SLAMF7 Protein (Ser23-His175), N-His tagged | +Inquiry |
SLAMF7-570H | Recombinant Human SLAMF7 Protein (Ser23-Met226), C-hFc and 6×His-tagged | +Inquiry |
SLAMF7-186H | Recombinant Human SLAMF7 protein, hFc-tagged | +Inquiry |
SLAMF7-121H | Recombinant Human SLAMF7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *