Recombinant Human SLC12A5 protein, GST-tagged
Cat.No. : | SLC12A5-301559H |
Product Overview : | Recombinant Human SLC12A5 (915-1043 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile915-Asn1043 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SLC12A5 solute carrier family 12 (potassium/chloride transporter), member 5 [ Homo sapiens ] |
Official Symbol | SLC12A5 |
Synonyms | SLC12A5; solute carrier family 12 (potassium/chloride transporter), member 5; solute carrier family 12 member 5; KCC2; KIAA1176; hKCC2; K-Cl cotransporter 2; neuronal K-Cl cotransporter; erythroid K-Cl cotransporter 2; electroneutral potassium-chloride cotransporter 2; |
Gene ID | 57468 |
mRNA Refseq | NM_001134771 |
Protein Refseq | NP_001128243 |
MIM | 606726 |
UniProt ID | Q9H2X9 |
◆ Recombinant Proteins | ||
Slc12a5-5904M | Recombinant Mouse Slc12a5 Protein, Myc/DDK-tagged | +Inquiry |
SLC12A5-8218M | Recombinant Mouse SLC12A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC12A5-301559H | Recombinant Human SLC12A5 protein, GST-tagged | +Inquiry |
SLC12A5-5426R | Recombinant Rat SLC12A5 Protein | +Inquiry |
SLC12A5-15211M | Recombinant Mouse SLC12A5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC12A5-1805HCL | Recombinant Human SLC12A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC12A5 Products
Required fields are marked with *
My Review for All SLC12A5 Products
Required fields are marked with *