Recombinant Human SLC12A7 protein, His-tagged
| Cat.No. : | SLC12A7-3853H |
| Product Overview : | Recombinant Human SLC12A7 protein(953-1004 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 953-1004 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | IHDRNTASHTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC12A7 solute carrier family 12 (potassium/chloride transporters), member 7 [ Homo sapiens ] |
| Official Symbol | SLC12A7 |
| Synonyms | SLC12A7; solute carrier family 12 (potassium/chloride transporters), member 7; solute carrier family 12 member 7; DKFZP434F076; KCC4; K-Cl cotransporter 4; potassium/chloride transporter KCC4; electroneutral potassium-chloride cotransporter 4; DKFZp434F076; |
| Gene ID | 10723 |
| mRNA Refseq | NM_006598 |
| Protein Refseq | NP_006589 |
| MIM | 604879 |
| UniProt ID | Q9Y666 |
| ◆ Recombinant Proteins | ||
| SLC12A7-1727H | Recombinant Human SLC12A7 protein, His & T7-tagged | +Inquiry |
| SLC12A7-5086R | Recombinant Rat SLC12A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC12A7-1514C | Recombinant Chicken SLC12A7 | +Inquiry |
| SLC12A7-5427R | Recombinant Rat SLC12A7 Protein | +Inquiry |
| SLC12A7-3853H | Recombinant Human SLC12A7 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC12A7-597HCL | Recombinant Human SLC12A7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC12A7 Products
Required fields are marked with *
My Review for All SLC12A7 Products
Required fields are marked with *
