Recombinant Human SLC16A2 Protein
| Cat.No. : | SLC16A2-3340H | 
| Product Overview : | Recombinant Human SLC16A2 Protein is produced by Wheat Germ (in vitro) expression system. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Description : | This gene encodes an integral membrane protein transporter of thyroid hormone; specifically, cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues including brain, heart, placenta, lung, kidney, skeletal muscle, and liver. This gene likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. | 
| Form : | Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol. | 
| Molecular Mass : | 67.5 kDa | 
| AA Sequence : | MGRGGGGLDVGGGGEGSRDRLSRDGLASWGAEPGGGGSGSGSSSPPSSSSCSSRNKYQPQSGSSGPSSHSPPAAMALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI | 
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Gene Name | SLC16A2 solute carrier family 16, member 2 (thyroid hormone transporter) [ Homo sapiens ] | 
| Official Symbol | SLC16A2 | 
| Synonyms | SLC16A2; MCT7; MCT8; XPCT; AHDS; MCT 7; MCT 8; MRX22; DXS128; DXS128E; | 
| Gene ID | 6567 | 
| mRNA Refseq | NM_006517 | 
| Protein Refseq | NP_006508 | 
| MIM | 300095 | 
| UniProt ID | P36021 | 
| ◆ Recombinant Proteins | ||
| SLC16A2-6790HF | Recombinant Full Length Human SLC16A2 Protein | +Inquiry | 
| SLC16A2-3340H | Recombinant Human SLC16A2 Protein | +Inquiry | 
| SLC16A2-8222Z | Recombinant Zebrafish SLC16A2 | +Inquiry | 
| SLC16A2-6784HF | Recombinant Full Length Human SLC16A2 Protein | +Inquiry | 
| SLC16A2-1346S | Recombinant Human SLC16A2 Protein (A2-I539), 8×His-MBP, Flag tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC16A2 Products
Required fields are marked with *
My Review for All SLC16A2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            