Recombinant Human SLC16A9 protein, His-tagged
Cat.No. : | SLC16A9-2743H |
Product Overview : | Recombinant Human SLC16A9 protein(185-300 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 185-300 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GSLMRPLQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVAL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC16A9 solute carrier family 16, member 9 (monocarboxylic acid transporter 9) [ Homo sapiens ] |
Official Symbol | SLC16A9 |
Synonyms | SLC16A9; solute carrier family 16, member 9 (monocarboxylic acid transporter 9); C10orf36, chromosome 10 open reading frame 36 , solute carrier family 16 (monocarboxylic acid transporters), member 9; monocarboxylate transporter 9; FLJ43803; MCT9; MCT 9; solute carrier family 16 member 9; solute carrier family 16 (monocarboxylic acid transporters), member 9; C10orf36; |
Gene ID | 220963 |
mRNA Refseq | NM_194298 |
Protein Refseq | NP_919274 |
MIM | 614242 |
UniProt ID | Q7RTY1 |
◆ Recombinant Proteins | ||
SLC16A9-15239M | Recombinant Mouse SLC16A9 Protein | +Inquiry |
SLC16A9-30H | Recombinant Human SLC16A9 Protein | +Inquiry |
SLC16A9-2743H | Recombinant Human SLC16A9 protein, His-tagged | +Inquiry |
SLC16A9-6789HF | Recombinant Full Length Human SLC16A9 Protein | +Inquiry |
SLC16A9-2884C | Recombinant Chicken SLC16A9 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC16A9 Products
Required fields are marked with *
My Review for All SLC16A9 Products
Required fields are marked with *
0
Inquiry Basket