Recombinant Human SLC16A9 protein, His-tagged

Cat.No. : SLC16A9-2743H
Product Overview : Recombinant Human SLC16A9 protein(185-300 aa), fused to His tag, was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 185-300 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GSLMRPLQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVAL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC16A9 solute carrier family 16, member 9 (monocarboxylic acid transporter 9) [ Homo sapiens ]
Official Symbol SLC16A9
Synonyms SLC16A9; solute carrier family 16, member 9 (monocarboxylic acid transporter 9); C10orf36, chromosome 10 open reading frame 36 , solute carrier family 16 (monocarboxylic acid transporters), member 9; monocarboxylate transporter 9; FLJ43803; MCT9; MCT 9; solute carrier family 16 member 9; solute carrier family 16 (monocarboxylic acid transporters), member 9; C10orf36;
Gene ID 220963
mRNA Refseq NM_194298
Protein Refseq NP_919274
MIM 614242
UniProt ID Q7RTY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC16A9 Products

Required fields are marked with *

My Review for All SLC16A9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon