Recombinant Human SLC19A2 protein, His&Myc-tagged
Cat.No. : | SLC19A2-4546H |
Product Overview : | Recombinant Human SLC19A2 protein(O60779)(215-293aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 215-293aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSR |
Gene Name | SLC19A2 solute carrier family 19 (thiamine transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC19A2 |
Synonyms | SLC19A2; solute carrier family 19 (thiamine transporter), member 2; TRMA; thiamine transporter 1; THTR1; thTr-1; solute carrier family 19 member 2; high affinity thiamine transporter; reduced folate carrier protein (RFC) like; TC1; THT1; THMD1; |
Gene ID | 10560 |
mRNA Refseq | NM_006996 |
Protein Refseq | NP_008927 |
MIM | 603941 |
UniProt ID | O60779 |
◆ Recombinant Proteins | ||
SLC19A2-4546H | Recombinant Human SLC19A2 protein, His&Myc-tagged | +Inquiry |
SLC19A2-4043R | Recombinant Rhesus Macaque SLC19A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC19A2-4227R | Recombinant Rhesus monkey SLC19A2 Protein, His-tagged | +Inquiry |
SLC19A2-0523H | Recombinant Human SLC19A2 Protein (D2-S497), 8×His-Strep, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC19A2-1617HCL | Recombinant Human SLC19A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC19A2 Products
Required fields are marked with *
My Review for All SLC19A2 Products
Required fields are marked with *
0
Inquiry Basket