Recombinant Human SLC1A2 protein, His-tagged

• Cat.No.: SLC1A2-2584H
• Product Overview: Recombinant Human SLC1A2 protein(460-574 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 460-574 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SLC1A2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Homo sapiens ]
• Official Symbol: SLC1A2
• Synonyms: SLC1A2; solute carrier family 1 (glial high affinity glutamate transporter), member 2; excitatory amino acid transporter 2; EAAT2; GLT 1; glutamate/aspartate transporter II; excitotoxic amino acid transporter 2; sodium-dependent glutamate/aspartate transporter 2; GLT-1
• Gene ID: 6506
• mRNA Refseq: NM_001195728
• Protein Refseq: NP_001182657
• MIM: 600300
• UniProt ID: P43004