Recombinant Human SLC1A2 protein, His-tagged
| Cat.No. : | SLC1A2-2584H |
| Product Overview : | Recombinant Human SLC1A2 protein(460-574 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 460-574 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC1A2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Homo sapiens ] |
| Official Symbol | SLC1A2 |
| Synonyms | SLC1A2; solute carrier family 1 (glial high affinity glutamate transporter), member 2; excitatory amino acid transporter 2; EAAT2; GLT 1; glutamate/aspartate transporter II; excitotoxic amino acid transporter 2; sodium-dependent glutamate/aspartate transporter 2; GLT-1; |
| Gene ID | 6506 |
| mRNA Refseq | NM_001195728 |
| Protein Refseq | NP_001182657 |
| MIM | 600300 |
| UniProt ID | P43004 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A2 Products
Required fields are marked with *
My Review for All SLC1A2 Products
Required fields are marked with *
