Recombinant Human SLC1A2 protein, His-tagged
Cat.No. : | SLC1A2-2584H |
Product Overview : | Recombinant Human SLC1A2 protein(460-574 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 460-574 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC1A2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC1A2 |
Synonyms | SLC1A2; solute carrier family 1 (glial high affinity glutamate transporter), member 2; excitatory amino acid transporter 2; EAAT2; GLT 1; glutamate/aspartate transporter II; excitotoxic amino acid transporter 2; sodium-dependent glutamate/aspartate transporter 2; GLT-1; |
Gene ID | 6506 |
mRNA Refseq | NM_001195728 |
Protein Refseq | NP_001182657 |
MIM | 600300 |
UniProt ID | P43004 |
◆ Recombinant Proteins | ||
SLC1A2-568H | Active Recombinant Human SLC1A2 protein, His-Flag-tagged(Detergent) | +Inquiry |
SLC1A2-1213H | Recombinant Human SLC1A2 Protein (M1-K574), 8×His-MBP, Flag tagged | +Inquiry |
SLC1A2-4230R | Recombinant Rhesus monkey SLC1A2 Protein, His-tagged | +Inquiry |
SLC1A2-6787HF | Recombinant Full Length Human SLC1A2 Protein, GST-tagged | +Inquiry |
SLC1A2-15253M | Recombinant Mouse SLC1A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC1A2-1618HCL | Recombinant Human SLC1A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A2 Products
Required fields are marked with *
My Review for All SLC1A2 Products
Required fields are marked with *