Recombinant Human SLC1A2 protein, His-tagged
Cat.No. : | SLC1A2-2584H |
Product Overview : | Recombinant Human SLC1A2 protein(460-574 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 460-574 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC1A2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC1A2 |
Synonyms | SLC1A2; solute carrier family 1 (glial high affinity glutamate transporter), member 2; excitatory amino acid transporter 2; EAAT2; GLT 1; glutamate/aspartate transporter II; excitotoxic amino acid transporter 2; sodium-dependent glutamate/aspartate transporter 2; GLT-1; |
Gene ID | 6506 |
mRNA Refseq | NM_001195728 |
Protein Refseq | NP_001182657 |
MIM | 600300 |
UniProt ID | P43004 |
◆ Recombinant Proteins | ||
SLC1A2-2114C | Recombinant Chicken SLC1A2 | +Inquiry |
SLC1A2-813M | Recombinant Mouse SLC1A2 Protein (143-238 aa), GST-tagged | +Inquiry |
SLC1A2-6299H | Recombinant Human SLC1A2 Protein (Pro460-Lys574), N-GST tagged | +Inquiry |
SLC1A2-6787HF | Recombinant Full Length Human SLC1A2 Protein, GST-tagged | +Inquiry |
SLC1A2-2584H | Recombinant Human SLC1A2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC1A2-1618HCL | Recombinant Human SLC1A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC1A2 Products
Required fields are marked with *
My Review for All SLC1A2 Products
Required fields are marked with *
0
Inquiry Basket