Recombinant Human SLC1A3 protein(146-236aa), His-tagged
Cat.No. : | SLC1A3-1377H |
Product Overview : | Recombinant Human SLC1A3 protein(146-236aa)(P43003), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 146-236aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
Gene Name | SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC1A3 |
Synonyms | SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip; GLAST-1; solute carrier family 1 member 3; sodium-dependent glutamate/aspartate transporter 1; GLAST1; FLJ25094 |
Gene ID | 6507 |
mRNA Refseq | NM_001166695 |
Protein Refseq | NP_001160167 |
MIM | 600111 |
UniProt ID | P43003 |
◆ Recombinant Proteins | ||
SLC1A3-8250M | Recombinant Mouse SLC1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC1A3-2704H | Recombinant Human SLC1A3, GST-tagged | +Inquiry |
SLC1A3-1376H | Recombinant Human SLC1A3 protein, His-KSI-tagged | +Inquiry |
SLC1A3-4047R | Recombinant Rhesus Macaque SLC1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC1A3-7854H | Recombinant Human SLC1A3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC1A3-1619HCL | Recombinant Human SLC1A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A3 Products
Required fields are marked with *
My Review for All SLC1A3 Products
Required fields are marked with *