Recombinant Human SLC1A3 protein, His-tagged
Cat.No. : | SLC1A3-3537H |
Product Overview : | Recombinant Human SLC1A3 protein(471-542 aa), fused to His tag, was expressed in E. coli. |
Availability | July 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 471-542 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC1A3 |
Synonyms | SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip; GLAST-1; solute carrier family 1 member 3; sodium-dependent glutamate/aspartate transporter 1; GLAST1; FLJ25094; |
Gene ID | 6507 |
mRNA Refseq | NM_001166695 |
Protein Refseq | NP_001160167 |
MIM | 600111 |
UniProt ID | P43003 |
◆ Recombinant Proteins | ||
SLC1A3-1376H | Recombinant Human SLC1A3 protein, His-KSI-tagged | +Inquiry |
SLC1A3-7854H | Recombinant Human SLC1A3 protein, GST-tagged | +Inquiry |
SLC1A3-15254M | Recombinant Mouse SLC1A3 Protein | +Inquiry |
SLC1A3-1377H | Recombinant Human SLC1A3 protein(146-236aa), His-tagged | +Inquiry |
SLC1A3-1215H | Recombinant Human SLC1A3 Protein (T2-M542), 8×His-MBP, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC1A3-1619HCL | Recombinant Human SLC1A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A3 Products
Required fields are marked with *
My Review for All SLC1A3 Products
Required fields are marked with *