Recombinant Human SLC22A14 protein, His-tagged

Cat.No. : SLC22A14-3656H
Product Overview : Recombinant Human SLC22A14 protein(92-184 aa), fused to His tag, was expressed in E. coli.
Availability December 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 92-184 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TAQKPYCNTSWILAVGPHLSKAEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC22A14 solute carrier family 22, member 14 [ Homo sapiens ]
Official Symbol SLC22A14
Synonyms SLC22A14; solute carrier family 22, member 14; ORCTL4, organic cationic transporter like 4 , solute carrier family 22 (organic cation transporter), member 14; solute carrier family 22 member 14; OCTL2; ORCTL-4; organic cation transporter-like 4; organic cationic transporter-like 4; solute carrier family 22 (organic cation transporter), member 14; OCTL4; ORCTL4; MGC163415;
Gene ID 9389
mRNA Refseq NM_004803
Protein Refseq NP_004794
MIM 604048
UniProt ID Q9Y267

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC22A14 Products

Required fields are marked with *

My Review for All SLC22A14 Products

Required fields are marked with *

0
cart-icon
0
compare icon