Recombinant Human SLC22A14 protein, His-tagged
Cat.No. : | SLC22A14-3656H |
Product Overview : | Recombinant Human SLC22A14 protein(92-184 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 92-184 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TAQKPYCNTSWILAVGPHLSKAEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC22A14 solute carrier family 22, member 14 [ Homo sapiens ] |
Official Symbol | SLC22A14 |
Synonyms | SLC22A14; solute carrier family 22, member 14; ORCTL4, organic cationic transporter like 4 , solute carrier family 22 (organic cation transporter), member 14; solute carrier family 22 member 14; OCTL2; ORCTL-4; organic cation transporter-like 4; organic cationic transporter-like 4; solute carrier family 22 (organic cation transporter), member 14; OCTL4; ORCTL4; MGC163415; |
Gene ID | 9389 |
mRNA Refseq | NM_004803 |
Protein Refseq | NP_004794 |
MIM | 604048 |
UniProt ID | Q9Y267 |
◆ Recombinant Proteins | ||
SLC22A14-3656H | Recombinant Human SLC22A14 protein, His-tagged | +Inquiry |
SLC22A14-2708H | Recombinant Human SLC22A14, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A14 Products
Required fields are marked with *
My Review for All SLC22A14 Products
Required fields are marked with *