Recombinant Human SLC25A36 protein, His-tagged
| Cat.No. : | SLC25A36-2741H |
| Product Overview : | Recombinant Human SLC25A36 protein(97-184 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 97-184 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC25A36 solute carrier family 25 (pyrimidine nucleotide carrier ), member 36 [ Homo sapiens ] |
| Official Symbol | SLC25A36 |
| Synonyms | SLC25A36; solute carrier family 25 (pyrimidine nucleotide carrier ), member 36; solute carrier family 25, member 36; solute carrier family 25 member 36; FLJ10618; PNC2; DKFZp564C053; |
| Gene ID | 55186 |
| mRNA Refseq | NM_001104647 |
| Protein Refseq | NP_001098117 |
| UniProt ID | Q96CQ1 |
| ◆ Recombinant Proteins | ||
| RFL5548GF | Recombinant Full Length Chicken Solute Carrier Family 25 Member 36(Slc25A36) Protein, His-Tagged | +Inquiry |
| SLC25A36-4841HF | Recombinant Full Length Human SLC25A36 Protein, GST-tagged | +Inquiry |
| SLC25A36-4219H | Recombinant Human SLC25A36 Protein, GST-tagged | +Inquiry |
| SLC25A36-1810C | Recombinant Chicken SLC25A36 | +Inquiry |
| SLC25A36-8287M | Recombinant Mouse SLC25A36 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A36-1765HCL | Recombinant Human SLC25A36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A36 Products
Required fields are marked with *
My Review for All SLC25A36 Products
Required fields are marked with *
