Recombinant Human SLC25A36 protein, His-tagged
Cat.No. : | SLC25A36-2741H |
Product Overview : | Recombinant Human SLC25A36 protein(97-184 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 97-184 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC25A36 solute carrier family 25 (pyrimidine nucleotide carrier ), member 36 [ Homo sapiens ] |
Official Symbol | SLC25A36 |
Synonyms | SLC25A36; solute carrier family 25 (pyrimidine nucleotide carrier ), member 36; solute carrier family 25, member 36; solute carrier family 25 member 36; FLJ10618; PNC2; DKFZp564C053; |
Gene ID | 55186 |
mRNA Refseq | NM_001104647 |
Protein Refseq | NP_001098117 |
UniProt ID | Q96CQ1 |
◆ Recombinant Proteins | ||
SLC25A36-4841HF | Recombinant Full Length Human SLC25A36 Protein, GST-tagged | +Inquiry |
SLC25A36-4219H | Recombinant Human SLC25A36 Protein, GST-tagged | +Inquiry |
RFL35076HF | Recombinant Full Length Human Solute Carrier Family 25 Member 36(Slc25A36) Protein, His-Tagged | +Inquiry |
SLC25A36-1810C | Recombinant Chicken SLC25A36 | +Inquiry |
RFL5548GF | Recombinant Full Length Chicken Solute Carrier Family 25 Member 36(Slc25A36) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A36-1765HCL | Recombinant Human SLC25A36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC25A36 Products
Required fields are marked with *
My Review for All SLC25A36 Products
Required fields are marked with *
0
Inquiry Basket