Recombinant Human SLC25A37 protein, GST-tagged

• Cat.No.: SLC25A37-301328H
• Product Overview: Recombinant Human SLC25A37 (1-44 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser44
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC25A37 solute carrier family 25 (mitochondrial iron transporter), member 37 [ Homo sapiens ]
• Official Symbol: SLC25A37
• Synonyms: SLC25A37; solute carrier family 25 (mitochondrial iron transporter), member 37; solute carrier family 25, member 37; mitoferrin-1; MFRN; MFRN1; mitoferrin; MSCP; predicted protein of HQ2217; mitochondrial iron transporter 1; mitochondrial solute carrier protein; MSC; HT015; PRO1278; PRO1584; PRO2217
• Gene ID: 51312
• mRNA Refseq: NM_016612
• Protein Refseq: NP_057696
• MIM: 610387
• UniProt ID: Q9NYZ2