Recombinant Human SLC26A3
Cat.No. : | SLC26A3-31415TH |
Product Overview : | Recombinant fragment of Human SLC26A3 with a N terminal proprietary tag; Predicted MW 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The protein encoded by this gene is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea. |
Molecular Weight : | 36.410kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT |
Sequence Similarities : | Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.Contains 1 STAS domain. |
Gene Name | SLC26A3 solute carrier family 26, member 3 [ Homo sapiens ] |
Official Symbol | SLC26A3 |
Synonyms | SLC26A3; solute carrier family 26, member 3; CLD, congenital chloride diarrhea , DRA; chloride anion exchanger; |
Gene ID | 1811 |
mRNA Refseq | NM_000111 |
Protein Refseq | NP_000102 |
MIM | 126650 |
Uniprot ID | P40879 |
Chromosome Location | 7q31 |
Pathway | Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; Multifunctional anion exchangers, organism-specific biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; |
Function | anion:anion antiporter activity; antiporter activity; secondary active sulfate transmembrane transporter activity; sequence-specific DNA binding transcription factor activity; transcription cofactor activity; |
◆ Recombinant Proteins | ||
SLC26A3-5484R | Recombinant Rat SLC26A3 Protein | +Inquiry |
SLC26A3-8300M | Recombinant Mouse SLC26A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC26A3-15341M | Recombinant Mouse SLC26A3 Protein | +Inquiry |
SLC26A3-31415TH | Recombinant Human SLC26A3 | +Inquiry |
SLC26A3-4310C | Recombinant Chicken SLC26A3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC26A3-1753HCL | Recombinant Human SLC26A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC26A3 Products
Required fields are marked with *
My Review for All SLC26A3 Products
Required fields are marked with *
0
Inquiry Basket