Recombinant Human SLC29A1 protein, GST-tagged

• Cat.No.: ENT1-12465H
• Product Overview: Recombinant Human SLC29A1(150-456 aa) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 150-456 aa
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Molecular Mass: 61 kDa
• AA Sequence: INSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFITACAVIILTIICYL GLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILKNISVLAFSVCFI FTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAVFMWPGKDSRWLPSLVLARLVFVPL LLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPKKVKPAEAETAGAIMAFFLCLGLALGAVFS FLFRAIV
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: SLC29A1 solute carrier family 29 (nucleoside transporters), member 1 [ Homo sapiens ]
• Official Symbol: SLC29A1
• Synonyms: SLC29A1; solute carrier family 29 (nucleoside transporters), member 1; ENT1; equilibrative nucleoside transporter 1; nucleoside transporter, es-type; solute carrier family 29 member 1; solute carrier family 29, member 1; equilibrative NBMPR-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside (NBMPR)-sensitive nucleoside transporter; MGC1465; MGC3778
• Gene ID: 2030
• mRNA Refseq: NM_001078174
• Protein Refseq: NP_001071642
• MIM: 602193
• UniProt ID: Q99808
• Chromosome Location: 6p21.1
• Pathway: Fluoropyrimidine Activity, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane, organism-specific biosystem; Transport of vitamins, nucleosides, and related molecules, organism-specific biosystem
• Function: nucleoside transmembrane transporter activity