Recombinant Human SLC29A4 protein, His-tagged
| Cat.No. : | SLC29A4-3944H |
| Product Overview : | Recombinant Human SLC29A4 protein(239-337 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 239-337 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVAR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC29A4 solute carrier family 29 (nucleoside transporters), member 4 [ Homo sapiens ] |
| Official Symbol | SLC29A4 |
| Synonyms | SLC29A4; solute carrier family 29 (nucleoside transporters), member 4; equilibrative nucleoside transporter 4; ENT4; FLJ34923; hENT4; solute carrier family 29 member 4; plasma membrane monoamine transporter; PMAT; |
| Gene ID | 222962 |
| mRNA Refseq | NM_001040661 |
| Protein Refseq | NP_001035751 |
| MIM | 609149 |
| UniProt ID | Q7RTT9 |
| ◆ Recombinant Proteins | ||
| SLC29A4-5070Z | Recombinant Zebrafish SLC29A4 | +Inquiry |
| SLC29A4-3944H | Recombinant Human SLC29A4 protein, His-tagged | +Inquiry |
| SLC29A4-15358M | Recombinant Mouse SLC29A4 Protein | +Inquiry |
| SLC29A4-8309M | Recombinant Mouse SLC29A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC29A4-602HCL | Recombinant Human SLC29A4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC29A4 Products
Required fields are marked with *
My Review for All SLC29A4 Products
Required fields are marked with *
