Recombinant Human SLC2A1 protein, His&Myc-tagged
| Cat.No. : | SLC2A1-3499H |
| Product Overview : | Recombinant Human SLC2A1 protein(P11166)(207-271aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 207-271aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.2 kDa |
| AA Sequence : | CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SLC2A1 solute carrier family 2 (facilitated glucose transporter), member 1 [ Homo sapiens ] |
| Official Symbol | SLC2A1 |
| Synonyms | SLC2A1; solute carrier family 2 (facilitated glucose transporter), member 1; GLUT, GLUT1; solute carrier family 2, facilitated glucose transporter member 1; DYT18; GLUT-1; hepG2 glucose transporter; glucose transporter type 1, erythrocyte/brain; PED; GLUT; DYT17; GLUT1; GLUT1DS; MGC141895; MGC141896; |
| Gene ID | 6513 |
| mRNA Refseq | NM_006516 |
| Protein Refseq | NP_006507 |
| MIM | 138140 |
| UniProt ID | P11166 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A1 Products
Required fields are marked with *
My Review for All SLC2A1 Products
Required fields are marked with *
