Recombinant Human SLC2A1 protein, His&Myc-tagged
Cat.No. : | SLC2A1-3499H |
Product Overview : | Recombinant Human SLC2A1 protein(P11166)(207-271aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 207-271aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.2 kDa |
AA Sequence : | CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SLC2A1 solute carrier family 2 (facilitated glucose transporter), member 1 [ Homo sapiens ] |
Official Symbol | SLC2A1 |
Synonyms | SLC2A1; solute carrier family 2 (facilitated glucose transporter), member 1; GLUT, GLUT1; solute carrier family 2, facilitated glucose transporter member 1; DYT18; GLUT-1; hepG2 glucose transporter; glucose transporter type 1, erythrocyte/brain; PED; GLUT; DYT17; GLUT1; GLUT1DS; MGC141895; MGC141896; |
Gene ID | 6513 |
mRNA Refseq | NM_006516 |
Protein Refseq | NP_006507 |
MIM | 138140 |
UniProt ID | P11166 |
◆ Recombinant Proteins | ||
SLC2A1-4079R | Recombinant Rhesus Macaque SLC2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A1-1754H | Recombinant Human SLC2A1 protein, His-SUMO-tagged | +Inquiry |
SLC2A1-3307M | Recombinant Mouse SLC2A1 protein, His-SUMO-tagged | +Inquiry |
SLC2A1-059H | Recombinant Human SLC2A1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC2A1-4263R | Recombinant Rhesus monkey SLC2A1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC2A1 Products
Required fields are marked with *
My Review for All SLC2A1 Products
Required fields are marked with *
0
Inquiry Basket