Recombinant Human SLC2A12 protein, GST-tagged
Cat.No. : | SLC2A12-6754H |
Product Overview : | Recombinant Human SLC2A12 protein(550-617 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 550-617 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | PETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC2A12 solute carrier family 2 (facilitated glucose transporter), member 12 [ Homo sapiens ] |
Official Symbol | SLC2A12 |
Synonyms | SLC2A12; solute carrier family 2 (facilitated glucose transporter), member 12; solute carrier family 2, facilitated glucose transporter member 12; GLUT8; GLUT12; GLUT-12; glucose transporter type 12; |
Gene ID | 154091 |
mRNA Refseq | NM_145176 |
Protein Refseq | NP_660159 |
MIM | 610372 |
UniProt ID | Q8TD20 |
◆ Recombinant Proteins | ||
SLC2A12-10823Z | Recombinant Zebrafish SLC2A12 | +Inquiry |
SLC2A12-673C | Recombinant Cynomolgus Monkey SLC2A12 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A12-0937H | Recombinant Human SLC2A12 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
SLC2A12-930C | Recombinant Cynomolgus SLC2A12 Protein, His-tagged | +Inquiry |
SLC2A12-6754H | Recombinant Human SLC2A12 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC2A12-1627HCL | Recombinant Human SLC2A12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A12 Products
Required fields are marked with *
My Review for All SLC2A12 Products
Required fields are marked with *