Recombinant Human SLC2A2
Cat.No. : | SLC2A2-28420TH |
Product Overview : | Recombinant fragment corresponding to amino acids 32-98 of Human Glucose Transporter GLUT2 with proprietary tag; Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 67 amino acids |
Description : | Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. |
Molecular Weight : | 33.000kDa inclusive of tags |
Tissue specificity : | Liver, insulin-producing beta cell, small intestine and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWS |
Sequence Similarities : | Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. |
Gene Name | SLC2A2 solute carrier family 2 (facilitated glucose transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC2A2 |
Synonyms | SLC2A2; solute carrier family 2 (facilitated glucose transporter), member 2; GLUT2; solute carrier family 2, facilitated glucose transporter member 2; |
Gene ID | 6514 |
mRNA Refseq | NM_000340 |
Protein Refseq | NP_000331 |
MIM | 138160 |
Uniprot ID | P11168 |
Chromosome Location | 3q26.2-q27 |
Pathway | Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Facilitative Na+-independent glucose transporters, organism-specific biosystem; |
Function | D-glucose transmembrane transporter activity; dehydroascorbic acid transporter activity; glucose transmembrane transporter activity; hexose transmembrane transporter activity; insulin receptor binding; |
◆ Recombinant Proteins | ||
SLC2A2-3829Z | Recombinant Zebrafish SLC2A2 | +Inquiry |
SLC2A2-28420TH | Recombinant Human SLC2A2 | +Inquiry |
SLC2A2-15363M | Recombinant Mouse SLC2A2 Protein | +Inquiry |
SLC2A2-0480H | Recombinant Human SLC2A2 Protein (T2-V524), 8×His-MBP, Flag tagged | +Inquiry |
SLC2A2-1781H | Recombinant Human SLC2A2 protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A2 Products
Required fields are marked with *
My Review for All SLC2A2 Products
Required fields are marked with *
0
Inquiry Basket