Recombinant Human SLC2A2 protein, GST-tagged
| Cat.No. : | SLC2A2-7856H |
| Product Overview : | Recombinant Human SLC2A2 protein(69-128 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 69-128 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SLC2A2 solute carrier family 2 (facilitated glucose transporter), member 2 [ Homo sapiens ] |
| Official Symbol | SLC2A2 |
| Synonyms | SLC2A2; solute carrier family 2 (facilitated glucose transporter), member 2; GLUT2; solute carrier family 2, facilitated glucose transporter member 2; GLUT-2; glucose transporter type 2, liver; |
| mRNA Refseq | NM_000340 |
| Protein Refseq | NP_000331 |
| MIM | 138160 |
| UniProt ID | P11168 |
| Gene ID | 6514 |
| ◆ Recombinant Proteins | ||
| SLC2A2-7118C | Recombinant Chicken SLC2A2 | +Inquiry |
| SLC2A2-2744H | Recombinant Human SLC2A2, GST-tagged | +Inquiry |
| SLC2A2-8312M | Recombinant Mouse SLC2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC2A2-0480H | Recombinant Human SLC2A2 Protein (T2-V524), 8×His-MBP, Flag tagged | +Inquiry |
| SLC2A2-1781H | Recombinant Human SLC2A2 protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A2 Products
Required fields are marked with *
My Review for All SLC2A2 Products
Required fields are marked with *



