Recombinant Human SLC2A2 protein, GST-tagged
Cat.No. : | SLC2A2-7856H |
Product Overview : | Recombinant Human SLC2A2 protein(69-128 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 69-128 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SLC2A2 solute carrier family 2 (facilitated glucose transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC2A2 |
Synonyms | SLC2A2; solute carrier family 2 (facilitated glucose transporter), member 2; GLUT2; solute carrier family 2, facilitated glucose transporter member 2; GLUT-2; glucose transporter type 2, liver; |
mRNA Refseq | NM_000340 |
Protein Refseq | NP_000331 |
MIM | 138160 |
UniProt ID | P11168 |
Gene ID | 6514 |
◆ Recombinant Proteins | ||
SLC2A2-15363M | Recombinant Mouse SLC2A2 Protein | +Inquiry |
SLC2A2-1781H | Recombinant Human SLC2A2 protein, His & GST-tagged | +Inquiry |
SLC2A2-3829Z | Recombinant Zebrafish SLC2A2 | +Inquiry |
SLC2A2-7118C | Recombinant Chicken SLC2A2 | +Inquiry |
RFL6763SF | Recombinant Full Length Pig Solute Carrier Family 2, Facilitated Glucose Transporter Member 2(Slc2A2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A2 Products
Required fields are marked with *
My Review for All SLC2A2 Products
Required fields are marked with *
0
Inquiry Basket