Recombinant Human SLC2A3 protein, His-tagged
Cat.No. : | SLC2A3-4744H |
Product Overview : | Recombinant Human SLC2A3 protein(207-281 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 207-281 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | ESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC2A3 solute carrier family 2 (facilitated glucose transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC2A3 |
Synonyms | SLC2A3; solute carrier family 2 (facilitated glucose transporter), member 3; GLUT3; solute carrier family 2, facilitated glucose transporter member 3; GLUT-3; glucose transporter type 3, brain; FLJ90380; |
Gene ID | 6515 |
mRNA Refseq | NM_006931 |
Protein Refseq | NP_008862 |
MIM | 138170 |
UniProt ID | P11169 |
◆ Recombinant Proteins | ||
SLC2A3-7060C | Recombinant Chicken SLC2A3 | +Inquiry |
SLC2A3-5156R | Recombinant Rat SLC2A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A3-5497R | Recombinant Rat SLC2A3 Protein | +Inquiry |
SLC2A3-0478H | Recombinant Human SLC2A3 Protein (G2-V496), 8×His-Strep, Flag tagged | +Inquiry |
SLC2A3-0479H | Recombinant Human SLC2A3 Protein (G2-V496), 8×His-MBP, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A3 Products
Required fields are marked with *
My Review for All SLC2A3 Products
Required fields are marked with *