Recombinant Human SLC2A4RG protein, GST-tagged
| Cat.No. : | SLC2A4RG-185H |
| Product Overview : | Recombinant Human SLC2A4RG(178 a.a. - 269 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 178-269 a.a. |
| Description : | The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.86 kDa |
| AA Sequence : | EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDT LTDGLSSLTPVSPTASM |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SLC2A4RG SLC2A4 regulator [ Homo sapiens ] |
| Official Symbol | SLC2A4RG |
| Synonyms | SLC2A4RG; SLC2A4 regulator; GEF; GLUT4 enhancer factor; HDBP1; Huntingtons disease gene regulatory region binding protein 1; Si 1 2; Si 1 2 19; Huntingtons disease gene regulatory region-binding protein 1; HDBP-1; Si-1-2; Si-1-2-19; |
| Gene ID | 56731 |
| mRNA Refseq | NM_020062 |
| Protein Refseq | NP_064446 |
| MIM | 609493 |
| UniProt ID | Q9NR83 |
| Chromosome Location | 20q13.33 |
| Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| SLC2A4RG-185H | Recombinant Human SLC2A4RG protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC2A4RG-1741HCL | Recombinant Human SLC2A4RG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A4RG Products
Required fields are marked with *
My Review for All SLC2A4RG Products
Required fields are marked with *
