"SLC2A4RG" Related Products

Recombinant Human SLC2A4RG protein, GST-tagged

Cat.No.: SLC2A4RG-185H
Product Overview: Recombinant Human SLC2A4RG(178 a.a. - 269 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 35.86 kDa
AA Sequence: EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDT LTDGLSSLTPVSPTASM
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SLC2A4RG SLC2A4 regulator [ Homo sapiens ]
Official Symbol: SLC2A4RG
Synonyms: SLC2A4RG; SLC2A4 regulator; GEF; GLUT4 enhancer factor; HDBP1; Huntingtons disease gene regulatory region binding protein 1; Si 1 2; Si 1 2 19; Huntingtons disease gene regulatory region-binding protein 1; HDBP-1; Si-1-2; Si-1-2-19;
Gene ID: 56731
mRNA Refseq: NM_020062
Protein Refseq: NP_064446
MIM: 609493
UniProt ID: Q9NR83
Chromosome Location: 20q13.33
Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.