Recombinant Human SLC2A4RG protein, GST-tagged

Cat.No. : SLC2A4RG-185H
Product Overview : Recombinant Human SLC2A4RG(178 a.a. - 269 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 178-269 a.a.
Description : The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.86 kDa
AA Sequence : EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDT LTDGLSSLTPVSPTASM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC2A4RG SLC2A4 regulator [ Homo sapiens ]
Official Symbol SLC2A4RG
Synonyms SLC2A4RG; SLC2A4 regulator; GEF; GLUT4 enhancer factor; HDBP1; Huntingtons disease gene regulatory region binding protein 1; Si 1 2; Si 1 2 19; Huntingtons disease gene regulatory region-binding protein 1; HDBP-1; Si-1-2; Si-1-2-19;
Gene ID 56731
mRNA Refseq NM_020062
Protein Refseq NP_064446
MIM 609493
UniProt ID Q9NR83
Chromosome Location 20q13.33
Function DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC2A4RG Products

Required fields are marked with *

My Review for All SLC2A4RG Products

Required fields are marked with *

0
cart-icon