Recombinant Human SLC2A4RG protein, GST-tagged

• Cat.No.: SLC2A4RG-185H
• Product Overview: Recombinant Human SLC2A4RG(178 a.a. - 269 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 178-269 a.a.
• Description: The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.86 kDa
• AA Sequence: EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDT LTDGLSSLTPVSPTASM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SLC2A4RG SLC2A4 regulator [ Homo sapiens ]
• Official Symbol: SLC2A4RG
• Synonyms: SLC2A4RG; SLC2A4 regulator; GEF; GLUT4 enhancer factor; HDBP1; Huntingtons disease gene regulatory region binding protein 1; Si 1 2; Si 1 2 19; Huntingtons disease gene regulatory region-binding protein 1; HDBP-1; Si-1-2; Si-1-2-19
• Gene ID: 56731
• mRNA Refseq: NM_020062
• Protein Refseq: NP_064446
• MIM: 609493
• UniProt ID: Q9NR83
• Chromosome Location: 20q13.33
• Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding