Recombinant Human SLC34A2 Protein (574-689 aa), His-tagged

Cat.No. : SLC34A2-1522H
Product Overview : Recombinant Human SLC34A2 Protein (574-689 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 574-689 aa
Description : May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border mbrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 15.1 kDa
AA Sequence : LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name SLC34A2 solute carrier family 34 member 2 [ Homo sapiens (human) ]
Official Symbol SLC34A2
Synonyms NPTIIb; NAPI-3B; NAPI-Iib;
Gene ID 10568
mRNA Refseq NM_001177999
Protein Refseq NP_001171470
UniProt ID O95436

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC34A2 Products

Required fields are marked with *

My Review for All SLC34A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon