Recombinant Human SLC35C2 protein, GST-tagged

Cat.No. : SLC35C2-301302H
Product Overview : Recombinant Human SLC35C2 (306-365 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Cys306-Gln365
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : CLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC35C2 solute carrier family 35, member C2 [ Homo sapiens ]
Official Symbol SLC35C2
Synonyms SLC35C2; solute carrier family 35, member C2; C20orf5, ovarian cancer overexpressed 1 , OVCOV1; solute carrier family 35 member C2; bA394O2.1; CGI 15; ovarian cancer overexpressed 1; ovarian cancer-overexpressed gene 1 protein; CGI-15; OVCOV1; C20orf5; BA394O2.1; FLJ37039; FLJ46434; MGC20633; MGC32079; MGC39183;
Gene ID 51006
mRNA Refseq NM_015945
Protein Refseq NP_057029
UniProt ID Q9NQQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC35C2 Products

Required fields are marked with *

My Review for All SLC35C2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon