Recombinant Human SLC35C2 protein, GST-tagged
| Cat.No. : | SLC35C2-301302H |
| Product Overview : | Recombinant Human SLC35C2 (306-365 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Cys306-Gln365 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | CLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SLC35C2 solute carrier family 35, member C2 [ Homo sapiens ] |
| Official Symbol | SLC35C2 |
| Synonyms | SLC35C2; solute carrier family 35, member C2; C20orf5, ovarian cancer overexpressed 1 , OVCOV1; solute carrier family 35 member C2; bA394O2.1; CGI 15; ovarian cancer overexpressed 1; ovarian cancer-overexpressed gene 1 protein; CGI-15; OVCOV1; C20orf5; BA394O2.1; FLJ37039; FLJ46434; MGC20633; MGC32079; MGC39183; |
| Gene ID | 51006 |
| mRNA Refseq | NM_015945 |
| Protein Refseq | NP_057029 |
| UniProt ID | Q9NQQ7 |
| ◆ Recombinant Proteins | ||
| SLC35C2-11920Z | Recombinant Zebrafish SLC35C2 | +Inquiry |
| SLC35C2-2557C | Recombinant Chicken SLC35C2 | +Inquiry |
| SLC35C2-301302H | Recombinant Human SLC35C2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC35C2-1732HCL | Recombinant Human SLC35C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC35C2 Products
Required fields are marked with *
My Review for All SLC35C2 Products
Required fields are marked with *
