Recombinant Human SLC35F3 protein, His&Myc-tagged
| Cat.No. : | SLC35F3-5675H |
| Product Overview : | Recombinant Human SLC35F3 protein(Q8IY50)(1-66aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-66a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKI |
| Gene Name | SLC35F3 solute carrier family 35, member F3 [ Homo sapiens ] |
| Official Symbol | SLC35F3 |
| Synonyms | SLC35F3; solute carrier family 35, member F3; solute carrier family 35 member F3; FLJ37712; |
| Gene ID | 148641 |
| mRNA Refseq | NM_173508 |
| Protein Refseq | NP_775779 |
| UniProt ID | Q8IY50 |
| ◆ Recombinant Proteins | ||
| SLC35F3-8344M | Recombinant Mouse SLC35F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC35F3-5675H | Recombinant Human SLC35F3 protein, His&Myc-tagged | +Inquiry |
| SLC35F3-15408M | Recombinant Mouse SLC35F3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC35F3 Products
Required fields are marked with *
My Review for All SLC35F3 Products
Required fields are marked with *
