Recombinant Human SLC37A3 protein, His-tagged

• Cat.No.: SLC37A3-20H
• Product Overview: Recombinant Human SLC37A3 protein(218-307 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 218-307 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: AGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNY

Gene Information

• Gene Name: SLC37A3 solute carrier family 37 (glycerol-3-phosphate transporter), member 3 [ Homo sapiens ]
• Official Symbol: SLC37A3
• Synonyms: SLC37A3; solute carrier family 37 (glycerol-3-phosphate transporter), member 3; sugar phosphate exchanger 3; DKFZp761N0624; solute carrier family 37 member 3; FLJ16367; MGC32939
• Gene ID: 84255
• mRNA Refseq: NM_032295
• Protein Refseq: NP_115671
• UniProt ID: Q8NCC5