Recombinant Human SLC37A3 protein, His-tagged

Cat.No. : SLC37A3-20H
Product Overview : Recombinant Human SLC37A3 protein(218-307 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 218-307 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : AGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNY
Gene Name SLC37A3 solute carrier family 37 (glycerol-3-phosphate transporter), member 3 [ Homo sapiens ]
Official Symbol SLC37A3
Synonyms SLC37A3; solute carrier family 37 (glycerol-3-phosphate transporter), member 3; sugar phosphate exchanger 3; DKFZp761N0624; solute carrier family 37 member 3; FLJ16367; MGC32939;
Gene ID 84255
mRNA Refseq NM_032295
Protein Refseq NP_115671
UniProt ID Q8NCC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC37A3 Products

Required fields are marked with *

My Review for All SLC37A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon