Recombinant Human SLC37A3 protein, His-tagged
Cat.No. : | SLC37A3-20H |
Product Overview : | Recombinant Human SLC37A3 protein(218-307 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 218-307 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | AGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNY |
Gene Name | SLC37A3 solute carrier family 37 (glycerol-3-phosphate transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC37A3 |
Synonyms | SLC37A3; solute carrier family 37 (glycerol-3-phosphate transporter), member 3; sugar phosphate exchanger 3; DKFZp761N0624; solute carrier family 37 member 3; FLJ16367; MGC32939; |
Gene ID | 84255 |
mRNA Refseq | NM_032295 |
Protein Refseq | NP_115671 |
UniProt ID | Q8NCC5 |
◆ Recombinant Proteins | ||
SLC37A3-05HFL | Recombinant Full Length Human SLC37A3 Protein, GST tagged | +Inquiry |
SLC37A3-20H | Recombinant Human SLC37A3 protein, His-tagged | +Inquiry |
SLC37A3-15417M | Recombinant Mouse SLC37A3 Protein | +Inquiry |
SLC37A3-1912C | Recombinant Chicken SLC37A3 | +Inquiry |
SLC37A3-8350M | Recombinant Mouse SLC37A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC37A3-1727HCL | Recombinant Human SLC37A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC37A3 Products
Required fields are marked with *
My Review for All SLC37A3 Products
Required fields are marked with *
0
Inquiry Basket