Recombinant Human SLC38A5 protein, GST-tagged
Cat.No. : | SLC38A5-301265H |
Product Overview : | Recombinant Human SLC38A5 (219-262 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu219-Val262 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LGCAIGHNETAMESEALVGLPSQGLNSSCEAQMFTVDSQMSYTV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SLC38A5 solute carrier family 38 member 5 [ Homo sapiens (human) ] |
Official Symbol | SLC38A5 |
Synonyms | SN2; JM24; SNAT5; pp7194 |
Gene ID | 92745 |
mRNA Refseq | NM_033518 |
Protein Refseq | NP_277053 |
MIM | 300649 |
UniProt ID | Q8WUX1 |
◆ Recombinant Proteins | ||
SLC38A5-8357M | Recombinant Mouse SLC38A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC38A5-15425M | Recombinant Mouse SLC38A5 Protein | +Inquiry |
SLC38A5-5527R | Recombinant Rat SLC38A5 Protein | +Inquiry |
SLC38A5-1797H | Recombinant Human SLC38A5 protein, GST-tagged | +Inquiry |
SLC38A5-301265H | Recombinant Human SLC38A5 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC38A5 Products
Required fields are marked with *
My Review for All SLC38A5 Products
Required fields are marked with *
0
Inquiry Basket