Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SLC38A5 protein, GST-tagged

Cat.No. : SLC38A5-1797H
Product Overview : Recombinant Human SLC38A5 protein(1-48 aa), fused to GST tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Protein length : 1-48 aa
AA Sequence : MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name : SLC38A5 solute carrier family 38 member 5 [ Homo sapiens (human) ]
Official Symbol : SLC38A5
Synonyms : SN2; JM24; SNAT5; pp7194
Gene ID : 92745
mRNA Refseq : NM_033518
Protein Refseq : NP_277053
MIM : 300649
UniProt ID : Q8WUX1

Products Types

◆ Recombinant Protein
SLC38A5-5186R Recombinant Rat SLC38A5 Protein, His (Fc)-Avi-tagged +Inquiry
SLC38A5-8357M Recombinant Mouse SLC38A5 Protein, His (Fc)-Avi-tagged +Inquiry
SLC38A5-15425M Recombinant Mouse SLC38A5 Protein +Inquiry
SLC38A5-5527R Recombinant Rat SLC38A5 Protein +Inquiry
SLC38A5-301265H Recombinant Human SLC38A5 protein, GST-tagged +Inquiry

See All SLC38A5 Recombinant Protein

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends