Recombinant Human SLC38A9 protein, His-tagged

• Cat.No.: SLC38A9-4699H
• Product Overview: Recombinant Human SLC38A9 protein(Q8NBW4)(1-119 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-119 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 14.8 kDa
• AASequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTS
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SLC38A9 solute carrier family 38, member 9 [ Homo sapiens ]
• Official Symbol: SLC38A9
• Synonyms: SLC38A9; solute carrier family 38, member 9; putative sodium-coupled neutral amino acid transporter 9; FLJ90709; FLJ46104; MGC120544
• Gene ID: 153129
• mRNA Refseq: NM_001258286
• Protein Refseq: NP_001245215
• UniProt ID: Q8NBW4