Recombinant Human SLC39A12 protein, His-tagged
| Cat.No. : | SLC39A12-3614H |
| Product Overview : | Recombinant Human SLC39A12 protein(1 - 202 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 202 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEYKFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC39A12 solute carrier family 39 (zinc transporter), member 12 [ Homo sapiens ] |
| Official Symbol | SLC39A12 |
| Synonyms | SLC39A12; solute carrier family 39 (zinc transporter), member 12; solute carrier family 39 (metal ion transporter), member 12; zinc transporter ZIP12; FLJ30499; zrt- and Irt-like protein 12; solute carrier family 39 member 12; LIV-1 subfamily of ZIP zinc transporter 8; ZIP-12; LZT-Hs8; bA570F3.1; MGC43205; MGC51099; |
| Gene ID | 221074 |
| mRNA Refseq | NM_001145195 |
| Protein Refseq | NP_001138667 |
| MIM | 608734 |
| UniProt ID | Q504Y0 |
| ◆ Recombinant Proteins | ||
| SLC39A12-6824HF | Recombinant Full Length Human SLC39A12 Protein, GST-tagged | +Inquiry |
| SLC39A12-8363M | Recombinant Mouse SLC39A12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC39A12-15432M | Recombinant Mouse SLC39A12 Protein | +Inquiry |
| SLC39A12-678H | Recombinant Human SLC39A12 Protein | +Inquiry |
| SLC39A12-3614H | Recombinant Human SLC39A12 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC39A12-1723HCL | Recombinant Human SLC39A12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A12 Products
Required fields are marked with *
My Review for All SLC39A12 Products
Required fields are marked with *
