Recombinant Human SLC39A12 protein, His-tagged

Cat.No. : SLC39A12-3614H
Product Overview : Recombinant Human SLC39A12 protein(1 - 202 aa), fused to His tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1 - 202 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEYKFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC39A12 solute carrier family 39 (zinc transporter), member 12 [ Homo sapiens ]
Official Symbol SLC39A12
Synonyms SLC39A12; solute carrier family 39 (zinc transporter), member 12; solute carrier family 39 (metal ion transporter), member 12; zinc transporter ZIP12; FLJ30499; zrt- and Irt-like protein 12; solute carrier family 39 member 12; LIV-1 subfamily of ZIP zinc transporter 8; ZIP-12; LZT-Hs8; bA570F3.1; MGC43205; MGC51099;
Gene ID 221074
mRNA Refseq NM_001145195
Protein Refseq NP_001138667
MIM 608734
UniProt ID Q504Y0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC39A12 Products

Required fields are marked with *

My Review for All SLC39A12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon