Recombinant Human SLC3A2

Cat.No. : SLC3A2-26956TH
Product Overview : Recombinant fragment of Human CD98 with N terminal proprietary tag; pedicted MWt: 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-trimester stage. Exp
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLA GLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDP NFGSKEDFDSLLQSAKKKSIRVILDLTPNY
Sequence Similarities : Belongs to the SLC3A transporter family.
Gene Name SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ]
Official Symbol SLC3A2
Synonyms SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2;
Gene ID 6520
mRNA Refseq NM_001012662
Protein Refseq NP_001012680
MIM 158070
Uniprot ID P08195
Chromosome Location 11q12-q22
Pathway Amino acid transport across the plasma membrane, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function calcium:sodium antiporter activity; catalytic activity; cation binding; neutral amino acid transmembrane transporter activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC3A2 Products

Required fields are marked with *

My Review for All SLC3A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon