Recombinant Human SLC3A2
Cat.No. : | SLC3A2-26956TH |
Product Overview : | Recombinant fragment of Human CD98 with N terminal proprietary tag; pedicted MWt: 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-trimester stage. Exp |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | IIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLA GLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDP NFGSKEDFDSLLQSAKKKSIRVILDLTPNY |
Sequence Similarities : | Belongs to the SLC3A transporter family. |
Gene Name : | SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ] |
Official Symbol : | SLC3A2 |
Synonyms : | SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2; |
Gene ID : | 6520 |
mRNA Refseq : | NM_001012662 |
Protein Refseq : | NP_001012680 |
MIM : | 158070 |
Uniprot ID : | P08195 |
Chromosome Location : | 11q12-q22 |
Pathway : | Amino acid transport across the plasma membrane, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function : | calcium:sodium antiporter activity; catalytic activity; cation binding; neutral amino acid transmembrane transporter activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
SLC3A2-229H | Recombinant Human SLC3A2 Protein, His-tagged | +Inquiry |
SLC3A2-1057H | Recombinant Human SLC3A2 protein(Arg206-Ala630), His-tagged, Biotinylated | +Inquiry |
SLC3A2-5197R | Recombinant Rat SLC3A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC3A2-2593H | Recombinant Human SLC3A2 protein(271-370 aa), C-hFc & C-His-tagged | +Inquiry |
Slc3a2-7031M | Recombinant Mouse Slc3a2 protein(Ala139-Ala565), His-tagged | +Inquiry |
◆ Lysates | ||
SLC3A2-1772MCL | Recombinant Mouse SLC3A2 cell lysate | +Inquiry |
SLC3A2-1199RCL | Recombinant Rat SLC3A2 cell lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket