Recombinant Human SLC44A1 Protein, GST-Tagged
Cat.No. : | SLC44A1-1330H |
Product Overview : | Human CDW92 partial ORF (NP_536856, 74 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SLC44A1 (Solute Carrier Family 44 Member 1) is a Protein Coding gene. Diseases associated with SLC44A1 include Postural Orthostatic Tachycardia Syndrome. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Synthesis of PC. GO annotations related to this gene include choline transmembrane transporter activity. An important paralog of this gene is SLC44A3. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLC44A1 solute carrier family 44, member 1 [ Homo sapiens ] |
Official Symbol | SLC44A1 |
Synonyms | SLC44A1; solute carrier family 44, member 1; CDW92, CDW92 antigen; choline transporter-like protein 1; CD92; CDw92; CHTL1; CTL1; CDW92 antigen; CDW92; RP11-287A8.1; |
Gene ID | 23446 |
mRNA Refseq | NM_080546 |
Protein Refseq | NP_536856 |
MIM | 606105 |
UniProt ID | Q8WWI5 |
◆ Recombinant Proteins | ||
SLC44A1-1330H | Recombinant Human SLC44A1 Protein, GST-Tagged | +Inquiry |
SLC44A1-1883H | Recombinant Human SLC44A1 protein, His & GST-tagged | +Inquiry |
SLC44A1-0296H | Recombinant Human SLC44A1 Protein (G2-A657), 8×His-MBP, Flag tagged | +Inquiry |
SLC44A1-2771H | Recombinant Human SLC44A1, His-tagged | +Inquiry |
SLC44A1-5199R | Recombinant Rat SLC44A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC44A1 Products
Required fields are marked with *
My Review for All SLC44A1 Products
Required fields are marked with *