Recombinant Human SLC4A3 protein(201-340 aa), C-His-tagged
Cat.No. : | SLC4A3-2775H |
Product Overview : | Recombinant Human SLC4A3 protein(P48751)(201-340 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 201-340 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HSSSSPSPRARASRLAGEKSRPWSPSASYDLRERLCPGSALGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRTQGGRGSPSGLAPILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRE |
Gene Name | SLC4A3 solute carrier family 4, anion exchanger, member 3 [ Homo sapiens ] |
Official Symbol | SLC4A3 |
Synonyms | AE3; SLC2C |
Gene ID | 6508 |
mRNA Refseq | NM_201574.2 |
Protein Refseq | NP_963868.2 |
MIM | 106195 |
UniProt ID | P48751 |
◆ Recombinant Proteins | ||
SLC4A3-3464C | Recombinant Callicebus moloch (Dusky titi monkey) SLC4A3, His-tagged | +Inquiry |
SLC4A3-8518Z | Recombinant Zebrafish SLC4A3 | +Inquiry |
SLC4A3-5550R | Recombinant Rat SLC4A3 Protein | +Inquiry |
SLC4A3-2775H | Recombinant Human SLC4A3 protein(201-340 aa), C-His-tagged | +Inquiry |
Slc4a3-3463R | Recombinant Rat Slc4a3, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC4A3 Products
Required fields are marked with *
My Review for All SLC4A3 Products
Required fields are marked with *