Recombinant Human SLC4A3 protein(201-340 aa), C-His-tagged
| Cat.No. : | SLC4A3-2775H |
| Product Overview : | Recombinant Human SLC4A3 protein(P48751)(201-340 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 201-340 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HSSSSPSPRARASRLAGEKSRPWSPSASYDLRERLCPGSALGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRTQGGRGSPSGLAPILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRE |
| Gene Name | SLC4A3 solute carrier family 4, anion exchanger, member 3 [ Homo sapiens ] |
| Official Symbol | SLC4A3 |
| Synonyms | AE3; SLC2C |
| Gene ID | 6508 |
| mRNA Refseq | NM_201574.2 |
| Protein Refseq | NP_963868.2 |
| MIM | 106195 |
| UniProt ID | P48751 |
| ◆ Recombinant Proteins | ||
| SLC4A3-3462H | Recombinant Human SLC4A3, His-tagged | +Inquiry |
| SLC4A3-15470M | Recombinant Mouse SLC4A3 Protein | +Inquiry |
| SLC4A3-3464C | Recombinant Callicebus moloch (Dusky titi monkey) SLC4A3, His-tagged | +Inquiry |
| SLC4A3-2775H | Recombinant Human SLC4A3 protein(201-340 aa), C-His-tagged | +Inquiry |
| SLC4A3-8390M | Recombinant Mouse SLC4A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC4A3 Products
Required fields are marked with *
My Review for All SLC4A3 Products
Required fields are marked with *



