Recombinant Human SLC4A5 protein, His-tagged
Cat.No. : | SLC4A5-2502H |
Product Overview : | Recombinant Human SLC4A5 protein(953-1019 aa), fused to His tag, was expressed in E. coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 953-1019 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC4A5 solute carrier family 4, sodium bicarbonate cotransporter, member 5 [ Homo sapiens ] |
Official Symbol | SLC4A5 |
Synonyms | SLC4A5; solute carrier family 4, sodium bicarbonate cotransporter, member 5; electrogenic sodium bicarbonate cotransporter 4; NBC4; NBCe2; MGC129662; |
Gene ID | 57835 |
mRNA Refseq | NM_021196 |
Protein Refseq | NP_067019 |
MIM | 606757 |
UniProt ID | Q9BY07 |
◆ Recombinant Proteins | ||
SLC4A5-5211R | Recombinant Rat SLC4A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC4A5-2502H | Recombinant Human SLC4A5 protein, His-tagged | +Inquiry |
SLC4A5-5552R | Recombinant Rat SLC4A5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC4A5 Products
Required fields are marked with *
My Review for All SLC4A5 Products
Required fields are marked with *